PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000203733
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 391aa    MW: 42874.4 Da    PI: 5.2195
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000203733genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-164489147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v  +G ++W++Iar +  gR++k+c++rw + 
    MDP0000203733 44 KGPWSPEEDAVLSRLVSNFGARNWSLIARGID-GRSGKSCRLRWCNQ 89
                     79******************************.***********985 PP

2Myb_DNA-binding51.52.3e-1696140147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T  Ed  +v a++ +G++ W++Iar ++ gRt++ +k++w++ 
    MDP0000203733  96 RKPFTDAEDRMIVAAHAVHGNK-WAAIARLLP-GRTDNAIKNHWNST 140
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8723990IPR017930Myb domain
SuperFamilySSF466895.99E-2942137IPR009057Homeodomain-like
SMARTSM007178.5E-134392IPR001005SANT/Myb domain
PfamPF002495.9E-154489IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-244597IPR009057Homeodomain-like
CDDcd001672.00E-124688No hitNo description
PROSITE profilePS5129425.64191145IPR017930Myb domain
SMARTSM007178.2E-1695143IPR001005SANT/Myb domain
PfamPF002491.3E-1396140IPR001005SANT/Myb domain
CDDcd001671.20E-1198141No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2398144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MEMEVAXDPA AVEIDAGDCG DCGEEAAAGG GAGSRRKSGR DNVKGPWSPE EDAVLSRLVS  60
NFGARNWSLI ARGIDGRSGK SCRLRWCNQL DPAVKRKPFT DAEDRMIVAA HAVHGNKWAA  120
IARLLPGRTD NAIKNHWNST LKRRCMDPEK IKLESGNMVE DVSLDKTKGS SEETFSYGDV  180
NSSKSMEGRE VSSFQHMDDQ DEYNGSSEVQ FSHEATEQPN LFRPVARISA FSVYNQSNSQ  240
ELESSFPRPI PAQGPLVRES KLDVGISKFL KGVYGELSVP DQCAHGCCCA QNGMNFQNSL  300
LGPEFVEFSE PPLFPSFELA AIATDISNLA WLKSGLENNS VRAVGETAGR ITTHGSQDQT  360
GRFEESRTNH LFPTEERKDR LMGMKTNVIS T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-40411444107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.128660.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744590.0DQ074459.1 Malus x domestica MYB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008345508.10.0PREDICTED: transcription factor MYB59-like
TrEMBLQ2LMF30.0Q2LMF3_MALDO; MYB2
STRINGVIT_08s0007g01540.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-100myb domain protein 1
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]